DPCfam | MC279415
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 425 ± 29 aa |
| Residues in low-complexity regions (%) | 8.89 |
| Residues in coiled-coil regions (%) | 1.39 |
| Predicted disordered residues (%) | 2.01 |
| Average transmembrane regions | 9.38 |
| Dominant Pfam architecture(s) | PF14264 |
| Sequences matching dominant architecture (%) | 99.12 |
| Average overlap percent | 70.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00050A1BB6 | 37-475 | 439 | IIVAVFSFLYVLPIILTNTFYIDDMNRTVFGYDWDRDARFISSKIMHLLSFQKDIVYSGYPFSNIFSSFLLAFSGFLLCYSIGIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q69SG2-F1 | 40-124 | 21.11 | 84.76 | View in AlphaFoldDB ↗ |