DPCfam | MC279337
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 172 ± 26 aa |
| Residues in low-complexity regions (%) | 7.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.66 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2A6885 | 21-195 | 175 | VGNQQIDDNFMLDILEELCHENISEYVKLQLLFALQEKVSSFSSDITSIECAVGSLKDMFLHPSGHPSQFYLSQILVTGTCLVIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F6S215-F1 | 19-198 | 98.32 | 87.98 | View in AlphaFoldDB ↗ |