DPCfam | MC27932
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Residues in low-complexity regions (%) | 7.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.07 |
| Average transmembrane regions | 0.49 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5Y0N3 | 1-128 | 128 | MIPEGTDIPALSAQLSEDGVAFSNPELANSQEVQAPIEAALQDSHGIAVVDVHPQRLADTRDIAQELQDATGLDTVIVQTTRSVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O53167-F1 | 17-157 | 99.31 | 96.23 | View in AlphaFoldDB ↗ |