DPCfam | MC278812
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Residues in low-complexity regions (%) | 5.35 |
| Residues in coiled-coil regions (%) | 2.4 |
| Predicted disordered residues (%) | 24.25 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08216 |
| Sequences matching dominant architecture (%) | 96.28 |
| Average overlap percent | 73.83 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C4FAI0 | 77-156 | 80 | CLNLERAINKNREMRTKFENNPESYPELNRLGTLGSLVGLLSHENVDITIAVVELLQELTDDDVLENQEDAVMAMVRSLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8WYA6-F1 | 71-179 | 97.32 | 93.21 | View in AlphaFoldDB ↗ |