DPCfam | MC278753
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Residues in low-complexity regions (%) | 13.1 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 49.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12881 |
| Sequences matching dominant architecture (%) | 95.35 |
| Average overlap percent | 34.74 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007627DC0 | 463-573 | 111 | EIPPEVIQELMDILDELVGPTNIATWEPFHLSIEDIAANLGEEGLEHQPMEDDLYPDPSLLSYIDEGFVNKMETMINPHFLEELL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1L443-F1 | 382-499 | 98.33 | 69.21 | View in AlphaFoldDB ↗ |