DPCfam | MC278255
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 158 ± 19 aa |
| Residues in low-complexity regions (%) | 15.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13912 |
| Sequences matching dominant architecture (%) | 11.36 |
| Average overlap percent | 11.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060YJ62 | 2-155 | 154 | CSVCQRDFKSLPALNGHMRSHRGLRGQPGRSQTYRTQKEGVIPGSPVPIVMPVSVPVRLPASPFPCLEEEHQEGQGRRGQGRRGW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96PN7-F1 | 531-729 | 98.56 | 44.62 | View in AlphaFoldDB ↗ |