DPCfam | MC277677
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 451 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Residues in low-complexity regions (%) | 11.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.8 |
| Average transmembrane regions | 2.32 |
| Dominant Pfam architecture(s) | PF04172 |
| Sequences matching dominant architecture (%) | 99.73 |
| Average overlap percent | 35.69 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U1NXS0 | 8-85 | 78 | VITYIIYRISKKIYGKWAIPFFHPLLIAPILLIVLIFLTHVSANQYLKDSQLLTHLLGPATIAFAVPIYKNLKIVKKY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132P5B4-F1 | 7-90 | 100.00 | 89.89 | View in AlphaFoldDB ↗ |