DPCfam | MC277470
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Residues in low-complexity regions (%) | 0.18 |
| Residues in coiled-coil regions (%) | 0.29 |
| Predicted disordered residues (%) | 18.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00169 |
| Sequences matching dominant architecture (%) | 2.86 |
| Average overlap percent | 80.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2U455 | 277-368 | 92 | DISTEEKDIVVKRADLKKHLTLMDVEGKPIVCSWTGQPQSVCLFHKGDEILAINDLHAGTVEEVHMYLSKSLKNEVKVTILRLHG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R245-F1 | 330-418 | 96.77 | 79.80 | View in AlphaFoldDB ↗ |