DPCfam | MC277406
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 100 ± 15 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 16.55 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00764 |
| Sequences matching dominant architecture (%) | 97.76 |
| Average overlap percent | 44.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D3HJT7 | 295-395 | 101 | LDRSTLHLKQSLQHTYANLVYEGRWFSHAKKALDALIDVTQQHITGTVALQLFKGNIIPESMHSPYSLHDPALATFEEDSVYNQK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2JWE1-F1 | 281-391 | 99.10 | 98.07 | View in AlphaFoldDB ↗ |