DPCfam | MC277146
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 108 ± 20 aa |
| Residues in low-complexity regions (%) | 11.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07939 |
| Sequences matching dominant architecture (%) | 58.85 |
| Average overlap percent | 39.51 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000511D95A | 86-168 | 83 | GSGPISLNKEEVKACRDLMIGFPCGHLRVELPVAFSDMQADAAGTCDDLSPVANWKIASPDDDPEKMKARIKVWAQAVVLMSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MEV4-F1 | 113-226 | 99.08 | 76.91 | View in AlphaFoldDB ↗ |