DPCfam | MC277091
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 232 ± 21 aa |
| Residues in low-complexity regions (%) | 4.04 |
| Residues in coiled-coil regions (%) | 13.22 |
| Predicted disordered residues (%) | 32.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N6UBA0 | 26-277 | 252 | LNEVVESYEKRLQEQIDLAKIDIANDLASQLQRLISNESEDEDWPPELLKFRDKFTSKHETEINHIKEQHNSEMTKLKEEHFKIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IK14-F1 | 383-418 | 14.81 | 94.26 | View in AlphaFoldDB ↗ |