DPCfam | MC277077
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 121 ± 29 aa |
| Residues in low-complexity regions (%) | 9.68 |
| Residues in coiled-coil regions (%) | 0.26 |
| Predicted disordered residues (%) | 51.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08332 |
| Sequences matching dominant architecture (%) | 69.23 |
| Average overlap percent | 11.88 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146XZ68 | 136-233 | 98 | RQETVECLKKFNARRKLKGAILTTMLVSRNFSAAKTLLNKKADVKKRKSSSTVQYMESSDSSNTTVEDEDVKARKQEIIKITEQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q923T9-F1 | 284-421 | 100.00 | 53.15 | View in AlphaFoldDB ↗ |