DPCfam | MC277036
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 472 ± 40 aa |
| Residues in low-complexity regions (%) | 13.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.79 |
| Average transmembrane regions | 0.95 |
| Dominant Pfam architecture(s) | PF00069 |
| Sequences matching dominant architecture (%) | 14.61 |
| Average overlap percent | 34.44 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D0L9B1 | 710-1218 | 509 | LVPGAAVAGGRYRLLDHHGGTRGLQFWRALDVNLDRNVALTFVDADQLAPPPERGVAVKTSDQGPQAVLSRTLLLGQVNSDGVAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P9WJK2-F1 | 709-1179 | 99.79 | 81.38 | View in AlphaFoldDB ↗ |