DPCfam | MC276830
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 338 ± 59 aa |
| Residues in low-complexity regions (%) | 8.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.37 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04194 |
| Sequences matching dominant architecture (%) | 69.13 |
| Average overlap percent | 42.21 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V3ZRJ0 | 19-355 | 337 | FVEEVDSECLLSYQFPSKVGGLPAWLSLKPLPCLDELQCRKCDEPTVFLLQVYAPRDHSELTFHRTIFIFICRNPACCQPNNNDN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1MTH6-F1 | 21-342 | 99.41 | 87.14 | View in AlphaFoldDB ↗ |