DPCfam | MC276680
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 146 ± 19 aa |
| Residues in low-complexity regions (%) | 1.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02511 |
| Sequences matching dominant architecture (%) | 60.0 |
| Average overlap percent | 12.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4AWL3 | 140-272 | 133 | FALRANEMAQPEIRKVSELMQAAYEASTPKQLSDDEWHLPLIQAEEYDGVFEKSDDARMISAARCARVSYLTHEGKRDLSADIVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O66883-F1 | 15-63 | 37.06 | 91.44 | View in AlphaFoldDB ↗ |