DPCfam | MC276673
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 228 ± 22 aa |
| Residues in low-complexity regions (%) | 3.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.65 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03746 |
| Sequences matching dominant architecture (%) | 97.29 |
| Average overlap percent | 98.21 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N4VLC9 | 5-242 | 238 | QVEVNCDMGEGFGKWKMGPDEELMKFIDVANVACGFHAGDPSIMLRTLRLAKQHGVRVGAHPGFPDLFGFGRRRMEIDPEDMYAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0JR24-F1 | 4-241 | 99.58 | 95.84 | View in AlphaFoldDB ↗ |