DPCfam | MC276252
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 384 ± 54 aa |
| Residues in low-complexity regions (%) | 3.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.71 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF07974 |
| Sequences matching dominant architecture (%) | 5.26 |
| Average overlap percent | 6.31 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F4PXI4 | 333-738 | 406 | LETLIFSGNNINQVPWNIFNNAPLLSLSLSSNPGLVGTVPESMCGIKKLDINQTGIQAVPNCFWCYDTASSVLVTSLPRPPGNLC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86AQ9-F1 | 523-907 | 99.75 | 88.83 | View in AlphaFoldDB ↗ |