DPCfam | MC275836
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1831 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00019 |
| Sequences matching dominant architecture (%) | 96.82 |
| Average overlap percent | 90.66 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S0UHE4 | 338-437 | 100 | ASNKGCRRRTLYVDFKDLGWQDWVIAPDGYHAYYCDGFCSFPLNNHMNATNHAIVQTLVHLIDPTRTSEAKCAPSSLRSMKILFI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P22003-F1 | 346-454 | 98.04 | 90.73 | View in AlphaFoldDB ↗ |