DPCfam | MC275823
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 152 ± 20 aa |
| Residues in low-complexity regions (%) | 2.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9UFI1 | 53-193 | 141 | DWYAVCEGTAFTRASAYAGPGPHPVKIFGAPSPGDGAKQDPDKPPAEWDPRRADQVRLVACAEEIDETGLGEVECPRYVNRFPFD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ERN7-F1 | 317-455 | 94.08 | 91.83 | View in AlphaFoldDB ↗ |