DPCfam | MC275801
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Residues in low-complexity regions (%) | 2.02 |
| Residues in coiled-coil regions (%) | 0.19 |
| Predicted disordered residues (%) | 25.97 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0UFB2 | 288-356 | 69 | IDTMLTLMNVGESEGTPLYMAQVTQILREMSTAGGPFNYRAFKRHLKGKDFNPAQTSMLQMRLGLLESF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W536-F1 | 228-314 | 98.85 | 83.94 | View in AlphaFoldDB ↗ |