DPCfam | MC275617
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 771 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Residues in low-complexity regions (%) | 2.56 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 19.16 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09684 |
| Sequences matching dominant architecture (%) | 98.71 |
| Average overlap percent | 83.04 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B1MER0 | 4-166 | 163 | SLLPPSASNFMRCAEAVGTRITDIPVDLNTLWSPDTCPVHLLPYLAWAFSVDRWDRNWPEETKRQVIRDAWLIHRHKGTISALRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZMU4-F1 | 5-148 | 96.50 | 93.16 | View in AlphaFoldDB ↗ |