DPCfam | MC275397
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Residues in low-complexity regions (%) | 13.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08687 |
| Sequences matching dominant architecture (%) | 92.86 |
| Average overlap percent | 38.94 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3MZL5 | 1043-1151 | 108 | LADILDPGVRMRTTMDLMEGIFPKDEHLLEGAQQRRKLLPKGPSPRTAEERREETSVLAAAPLATNSTYYSTSAPKAELLIKMKD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q13796-F1 | 1312-1435 | 98.43 | 62.71 | View in AlphaFoldDB ↗ |