DPCfam | MC274560
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Residues in low-complexity regions (%) | 3.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B2RXQ4 | 1101-1176 | 76 | SVFNHLEELRLHLEQEMGFEKFFEVYEKVKAIHEDEDENIEICSTIVENILGNEHQHLYAKILHLVMADGAYQEDN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P51954-F1 | 1112-1199 | 97.78 | 75.76 | View in AlphaFoldDB ↗ |