DPCfam | MC274444
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Residues in low-complexity regions (%) | 4.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 55.81 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12927 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 92.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q4WPD9 | 505-593 | 88 | PEGTKGKVLADTLVERTVSEGAAVAPEPDELDEQLHRKEIATEFYRMRNRKIQQNGGFLDDEPEMVPIDTDEAPKRVSKFKAARM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NNB2-F1 | 533-616 | 96.43 | 70.84 | View in AlphaFoldDB ↗ |