DPCfam | MC274418
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Residues in low-complexity regions (%) | 1.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.92 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04800 |
| Sequences matching dominant architecture (%) | 99.31 |
| Average overlap percent | 89.45 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5K7N6 | 67-167 | 101 | APAELLHRPVRIFRPTKNTMQSAKGKTKRWIIDFDVLQGAGRWENRLMGWASSADYVQGTTLAFRSKEDAIYFAEKQGWPYKVDE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q502E4-F1 | 63-158 | 100.00 | 96.79 | View in AlphaFoldDB ↗ |