DPCfam | MC274096
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Residues in low-complexity regions (%) | 6.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 45.35 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00784 |
| Sequences matching dominant architecture (%) | 1.64 |
| Average overlap percent | 0.97 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005BADB40 | 1483-1638 | 156 | EQFAGWILWSRGLEGPPRGWSVSLHSRDSWQDLAGCDFVLDLIGQTEDLGDPAGPHSYPIAPQSLAEDIPPAPGVQAPSLPPGPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U3JAY7-F1 | 244-392 | 98.73 | 49.66 | View in AlphaFoldDB ↗ |