DPCfam | MC273859
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Residues in low-complexity regions (%) | 4.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.7 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF17391- PF01175 |
| Sequences matching dominant architecture (%) | 97.18 |
| Average overlap percent | 42.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q86AX3 | 164-286 | 123 | MGLFPSNESSPRVIVTNGMVIPNYSSHKDYERMYAQGVTQYGQMTAGSYCYIGPQGIVHGTTITLLNAGRKYLGVESLIGKVFVS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GUA8-F1 | 88-205 | 99.16 | 97.17 | View in AlphaFoldDB ↗ |