DPCfam | MC273852
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1191 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.24 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00100 |
| Sequences matching dominant architecture (%) | 39.5 |
| Average overlap percent | 46.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q93532 | 21-133 | 113 | QIDNGLQGEPLIRCGSESLSINFKTQGAFEGHVYVKGHYSMKHCRTDATLESQVNLTVSYSACDVIRQRSSNPKGIMMTATIIIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q03755-F1 | 27-131 | 97.20 | 87.17 | View in AlphaFoldDB ↗ |