DPCfam | MC273747
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Residues in low-complexity regions (%) | 3.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00068B1216 | 3-118 | 116 | RNLAQIALAAFETPLLLHPRKAEVIASVLAEHMDGVAPMLDLSAAKAEVESARSGRSQMLDRFDGERRGPRLKDAYGDTYVQTRY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZMZ6-F1 | 4-92 | 98.88 | 80.37 | View in AlphaFoldDB ↗ |