DPCfam | MC273627
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00150 |
| Sequences matching dominant architecture (%) | 94.12 |
| Average overlap percent | 35.05 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q7S938 | 65-183 | 119 | GNRWSGDLRGWPHGVHDPAQQLAASWHVYAPGPRLDSLRDLVVRPVAGRYPVVASEFGEKDCAPGWVENFMSWADDAGISYLAWT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q54MB3-F1 | 217-348 | 100.00 | 96.39 | View in AlphaFoldDB ↗ |