DPCfam | MC273512
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12417 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 72.49 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178Z2K8 | 395-487 | 93 | EIDFNHRSIGIWVLDFDQCKEFAHDQGGVKQLERGFYFNDPYYPRPVSTDPKDVALWNTFKECYLDTSAAFIASGMPQQFIDAVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2FAS3-F1 | 302-388 | 94.62 | 94.17 | View in AlphaFoldDB ↗ |