DPCfam | MC2734
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 133 ± 10 aa |
| Residues in low-complexity regions (%) | 0.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M3HHY4 | 14-135 | 122 | PGAQGIEGVVRVVSGNQMPAPGVKRGPFQGVKTQVYVFELTNISQVVRRGSSSYYSSLRTRLITIADTDSTGHFCVCLPEGRYSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7PAT3-F1 | 315-373 | 44.78 | 85.80 | View in AlphaFoldDB ↗ |