DPCfam | MC273001
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Residues in low-complexity regions (%) | 3.64 |
| Residues in coiled-coil regions (%) | 0.44 |
| Predicted disordered residues (%) | 21.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13776 |
| Sequences matching dominant architecture (%) | 99.22 |
| Average overlap percent | 92.7 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E5JUA6 | 1-89 | 89 | MKWNWQLENWPNFTWDSDKLVVFEQSFTENAGIIIGSSQHISQEGKQNLFIDLMCTDALDSSEIEGEHLNRDSVQSSIQKELGLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I5W2-F1 | 6-91 | 98.85 | 93.77 | View in AlphaFoldDB ↗ |