DPCfam | MC272940
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 188 ± 14 aa |
| Residues in low-complexity regions (%) | 3.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.38 |
| Average transmembrane regions | 0.95 |
| Dominant Pfam architecture(s) | PF12698 |
| Sequences matching dominant architecture (%) | 33.9 |
| Average overlap percent | 16.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A1SV74 | 3-178 | 176 | FFRQVQALTWKNLLVVAFRHPVGFLLTFYCAPIAILIVLAMMPTWILGNLGRLSRLESPSGLTTLNNAIFGGQKLVISQTPNLGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1H0D1-F1 | 3-192 | 99.47 | 84.46 | View in AlphaFoldDB ↗ |