DPCfam | MC272737
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 150 ± 12 aa |
| Residues in low-complexity regions (%) | 2.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.44 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3ZNL0 | 378-525 | 148 | FFLEQWAIQEESLAGMRIQRMVNGGSARLLHHQLVAVQPTDAKIFMLGMIRWLQVSENLELRAGVRIIPGVPRGIAFRPTGVNVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HUK7-F1 | 432-573 | 96.60 | 91.38 | View in AlphaFoldDB ↗ |