DPCfam | MC272573
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 579 ± 39 aa |
| Residues in low-complexity regions (%) | 16.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.3 |
| Average transmembrane regions | 1.86 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F0LF83 | 6-629 | 624 | AVLAFVLAAVLIGTGIAQRTIFLGPKDVTAELSVKAPQAFTVIDSAVLRAHPGEQTLVAHGDGTIFVAQARTADLEAWLSDTSYN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q82AY2-F1 | 35-329 | 53.44 | 95.94 | View in AlphaFoldDB ↗ |