DPCfam | MC272359
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 271 |
|---|---|
| Mean domain length (aa) | 179 ± 27 aa |
| Residues in low-complexity regions (%) | 3.84 |
| Residues in coiled-coil regions (%) | 1.3 |
| Predicted disordered residues (%) | 16.55 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03177 |
| Sequences matching dominant architecture (%) | 90.87 |
| Average overlap percent | 48.04 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T2M845 | 766-934 | 169 | EYVQQRQNIILSLINHGYYEQAATIGEKYEDFIMLILLCEKTNDSYRLNRYKSMFLSQGFESELYRYYVEKGYWEKLLVANVKSQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VCW3-F1 | 875-1048 | 99.43 | 87.05 | View in AlphaFoldDB ↗ |