DPCfam | MC27218
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 150 ± 23 aa |
| Residues in low-complexity regions (%) | 2.26 |
| Residues in coiled-coil regions (%) | 0.19 |
| Predicted disordered residues (%) | 23.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05823 |
| Sequences matching dominant architecture (%) | 91.3 |
| Average overlap percent | 86.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B2UVQ3 | 150-285 | 136 | MLRTTIIISVCFAYALAFVMPLSMSNIPEEYKEFVPEAVQNFYKDLTPEDKQILREIADHHSQYPNVDAALNALKEKSEKLYAKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7GD14-F1 | 111-253 | 92.26 | 68.55 | View in AlphaFoldDB ↗ |