DPCfam | MC272056
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Residues in low-complexity regions (%) | 6.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 74.97 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF15228 |
| Sequences matching dominant architecture (%) | 95.65 |
| Average overlap percent | 92.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182Q659 | 8-98 | 91 | LVAGHPPAVKAGGMRIVQHKTPNTERPAKDPVEVIGLSNPSPNVNTGEVAETAKSSKHTDHSVEASQVAHAQKPPAAVHNKPVNH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IHI2-F1 | 7-110 | 100.00 | 65.64 | View in AlphaFoldDB ↗ |