DPCfam | MC271909
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 368 ± 58 aa |
| Residues in low-complexity regions (%) | 7.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.12 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01584- PF01584- PF01584 |
| Sequences matching dominant architecture (%) | 60.0 |
| Average overlap percent | 87.61 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G1H6U9 | 5-325 | 321 | FITFTLLEQLYGIDSQNIIEVIPLPEVIPIGKSPDFIEGFINLRGALILVINMREAIGLEKIPLSINNSIINVDINGLPIGFVVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PBM3-F1 | 31-172 | 50.18 | 89.43 | View in AlphaFoldDB ↗ |