DPCfam | MC271872
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Residues in low-complexity regions (%) | 6.08 |
| Residues in coiled-coil regions (%) | 2.13 |
| Predicted disordered residues (%) | 14.06 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF12031 |
| Sequences matching dominant architecture (%) | 98.18 |
| Average overlap percent | 22.07 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000645217F | 2052-2172 | 120 | MAVAVLSHLAQGDPTAARAIALQKASVSNLVAFLEDGVSMAQYQQNPHSLLHMGHLPMDPPSVNMMCRAAKGLLAMAKVEENKKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7E4J9-F1 | 508-626 | 98.35 | 90.32 | View in AlphaFoldDB ↗ |