DPCfam | MC2717
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 188 ± 17 aa |
| Residues in low-complexity regions (%) | 2.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04170- PF17185 |
| Sequences matching dominant architecture (%) | 82.14 |
| Average overlap percent | 92.39 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3ZAQ7 | 75-260 | 186 | TFEGVLPCADCPGITYHINLYRDGRFEARQEYLERGQVELVSGAWLLERRTLHLVNQQVNLPSFHFRSNRQLVMTDLSGRPIISS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P40710-F1 | 42-219 | 96.84 | 93.38 | View in AlphaFoldDB ↗ |