DPCfam | MC271423
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Residues in low-complexity regions (%) | 10.64 |
| Residues in coiled-coil regions (%) | 3.13 |
| Predicted disordered residues (%) | 4.34 |
| Average transmembrane regions | 2.25 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4DBC9 | 5-110 | 106 | VQLLFMVVFLEMGLILMFLFRTPLRKLIIMSLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQSRPADSVNPTDQILLAHQI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KZU5-F1 | 1-120 | 99.17 | 78.14 | View in AlphaFoldDB ↗ |