DPCfam | MC27140
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Residues in low-complexity regions (%) | 0.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11372 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 93.61 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V8EDG8 | 2-62 | 61 | IILVDKNDLMQLTGYSKTQSQNLIRRAKEKLVLEGLDWYKNKAIGRVPILAVEEILGYPIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A4U3YXC0-F1 | 2-59 | 98.31 | 94.26 | View in AlphaFoldDB ↗ |