DPCfam | MC270777
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Residues in low-complexity regions (%) | 7.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07714 |
| Sequences matching dominant architecture (%) | 86.42 |
| Average overlap percent | 7.4 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3DNM0 | 963-1039 | 77 | WMIDPDYRPRFKDLVKEFTTMARDPPRYVVIQNEEQMGTPSPVDNQFFRLLVEEEGNNLRELLDAEEYLVPQPNHFP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q01279-F1 | 953-1026 | 98.70 | 70.93 | View in AlphaFoldDB ↗ |