DPCfam | MC270767
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Residues in low-complexity regions (%) | 0.47 |
| Residues in coiled-coil regions (%) | 0.22 |
| Predicted disordered residues (%) | 11.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7NRS2 | 483-576 | 94 | YSRKCPQRPFEDFISILAKFPWHKGDFYTVSQRDLLHSSLITLIEILKGHFKKGRLIELNFRLLERLVHAGTTNTCFTEKQKFEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W193-F1 | 486-582 | 96.91 | 93.38 | View in AlphaFoldDB ↗ |