DPCfam | MC270656
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 147 ± 22 aa |
| Residues in low-complexity regions (%) | 3.61 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 18.79 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04640 |
| Sequences matching dominant architecture (%) | 86.89 |
| Average overlap percent | 47.98 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8FZF4 | 98-256 | 159 | PKWLEVLLDEKFFNSCLVHEYEKKNEENTFCLDCCLTLCIHCLPSHQNHKLLQIRRYIYQDVLLLKEANKVLDCSFVQPYTTNSA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7K2K4-F1 | 39-174 | 91.39 | 92.85 | View in AlphaFoldDB ↗ |