DPCfam | MC27051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 182 ± 12 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A059NWA4 | 6-190 | 185 | QLKCLFPSLITNKLEQKENVEYQWFETENTDVIGINKEEMNQETTDLLSIFLKPVTPEEAMLTDREKQWTQLLRNKKKRQAAEWP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94359-F1 | 2-185 | 97.81 | 82.63 | View in AlphaFoldDB ↗ |