DPCfam | MC270394
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3011 |
|---|---|
| Mean domain length (aa) | 166 ± 31 aa |
| Residues in low-complexity regions (%) | 2.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.69 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00629 |
| Sequences matching dominant architecture (%) | 59.85 |
| Average overlap percent | 92.07 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006E40D17 | 334-528 | 195 | NVDPLGWTGTGFDGSNGNWSITNAGGNSGGTGPADSFDGNTGVHLEYEASGNASDIASAISPAIDLTTAVDGAELAFLMHAFGDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5VYJ5-F1 | 73-228 | 98.17 | 77.77 | View in AlphaFoldDB ↗ |