DPCfam | MC27034
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1321 |
|---|---|
| Mean domain length (aa) | 192 ± 22 aa |
| Residues in low-complexity regions (%) | 1.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12945- PF07238 |
| Sequences matching dominant architecture (%) | 56.37 |
| Average overlap percent | 93.07 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B5X5T2 | 11-211 | 201 | EDKDTGKRYRCKIADIKEDKIYIDYPIDLETNRTVFLLIGQGLLVDFVSDGQIPYRFSSKVTGRELGNIPMLILSVPEPEDVRKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O67748-F1 | 161-337 | 92.27 | 94.14 | View in AlphaFoldDB ↗ |